PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G075600.1
Common NamePHAVU_010G075600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 97aa    MW: 10239.5 Da    PI: 8.213
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G075600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-183883147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +g+W++eEd +l ++v ++G ++W++Iar +  gR++k+c++rw + 
  Phvul.010G075600.1 38 KGPWSPEEDAILSRLVSKFGARNWSLIARGIS-GRSGKSCRLRWCNQ 83
                        79******************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.6243388IPR017930Myb domain
SMARTSM007176.2E-153786IPR001005SANT/Myb domain
PfamPF002492.2E-173883IPR001005SANT/Myb domain
SuperFamilySSF466892.39E-183994IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-233994IPR009057Homeodomain-like
CDDcd001673.86E-154082No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MEPEEAAVTA VSAYDGSGDE GMLVLDGGDV GGGKDRVKGP WSPEEDAILS RLVSKFGARN  60
WSLIARGISG RSGKSCRLRW CNQLDPSVKR KPFTGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-173594463B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150422e-97AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134782.12e-64hypothetical protein PHAVU_010G075600g
SwissprotQ9FDW16e-27MYB44_ARATH; Transcription factor MYB44
TrEMBLV7ARD42e-64V7ARD4_PHAVU; Uncharacterized protein
STRINGGLYMA03G15810.14e-37(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2009255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.15e-28myb domain protein 109